web Design Company Hyderabad, Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad, Vijayawada, web design services Hyderabad, website design services Hyderabad

2.50 Rating by CuteStat

outline.co.in is 1 decade 1 year old. It is a domain having co.in extension. It has a global traffic rank of #2956575 in the world. This website is estimated worth of $ 480.00 and have a daily income of around $ 2.00. As no active threats were reported recently by users, outline.co.in is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 285
Daily Pageviews: 570

Estimated Valuation

Income Per Day: $ 2.00
Estimated Worth: $ 480.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 2,956,575
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 9 H2 Headings: 3
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: 3
Total IFRAMEs: 1 Total Images: 15
Google Adsense: Not Applicable Google Analytics: UA-128092076-1

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig

- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati

- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95


.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 16 Oct 2020 10:46:42 GMT
Server: Apache
Last-Modified: Tue, 25 Aug 2020 16:39:51 GMT
Accept-Ranges: bytes
Content-Length: 37854
Content-Type: text/html

Domain Information

Domain Registrar: Endurance Domains Technology LLP
Registration Date: Jul 20, 2012, 10:06 AM 1 decade 1 year 9 months ago
Expiration Date: Jul 20, 2022, 10:06 AM 1 year 9 months 3 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns1.outline.co.in 103.24.202.179 India India
ns2.outline.co.in 103.24.202.179 India India

DNS Record Analysis

Host Type TTL Extra
outline.co.in A 14397 IP: 103.24.200.143
outline.co.in NS 86400 Target: ns1.lazybulls.com
outline.co.in NS 86400 Target: ns2.lazybulls.com
outline.co.in SOA 86400 MNAME: ns1.lazybulls.com
RNAME: root.i-h1-cs-r04-i0117-141.webazilla.com
Serial: 2019072505
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
outline.co.in MX 14400 Priority: 1
Target: aspmx.l.google.com
outline.co.in MX 14400 Priority: 5
Target: alt1.aspmx.l.google.com
outline.co.in MX 14400 Priority: 5
Target: alt2.aspmx.l.google.com
outline.co.in MX 14400 Priority: 10
Target: aspmx3.googlemail.com
outline.co.in MX 14400 Priority: 10
Target: aspmx2.googlemail.com
outline.co.in TXT 14400 TXT: v=spf1 ip4:103.24.200.143
ip4:103.24.200.141 ip4:142.44.174.193
ip4:103.24.202.75 +ip4:192.163.253.54
+ip4:162.144.54.172 +ip4:162.144.64.55
+a +mx +ip4:162.144.112.204 ~all

Similarly Ranked Websites

Phpcode Generator

- phpcode.hu
2,956,577 $ 240.00

Игровые площадки и комплектующие: качели, горки, песочницы

- deti-na-dache.ru

Деревянные Игровые площадки для дачи, улицы, загородного дома, детские домики, песочницы с крышками - лавочками и комплекты для самостоятельной сборки игровых комплексов на даче (DIY). Оригинальные конструкции, отличное качество.

2,956,584 $ 480.00

Главная - Форум Neuroscience.ru

- neuroscience.ru

Home

2,956,588 $ 480.00

BMW Cars, Combine Luxury with Performance | BMW Kuwait

- bmw-kuwait.com

Visit BMW Kuwait and explore what they have to offer. You may be still driving the same streets, but the game has definitely changed.

2,956,592 $ 480.00

Germain Volkswagen of Columbus | New Volkswagen Dealership in Columbus

- hatfieldvw.com

Germain Volkswagen of Columbus sells and services Volkswagen vehicles in the greater Columbus OH area.

2,956,609 $ 480.00

Full WHOIS Lookup

Domain Name: outline.co.in
Registry Domain ID: D6645409-IN
Registrar WHOIS Server:
Registrar URL: https://publicdomainregistry.com/
Updated Date: 2019-05-26T10:09:46Z
Creation Date: 2012-07-20T04:21:50Z
Registry Expiry Date: 2022-07-20T04:21:50Z
Registrar: Endurance Domains Technology LLP
Registrar IANA ID: 801217
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: Outline Designs
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Andhra Pradesh
Registrant Postal Code:
Registrant Country: IN
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please contact the Registrar listed above
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please contact the Registrar listed above
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please contact the Registrar listed above
Name Server: ns1.outline.co.in
Name Server: ns2.outline.co.in
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-10-16T10:46:55Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only ,and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator or a Registrar, or Neustar except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.